Protein Info for BPHYT_RS22700 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF01266: DAO" amino acids 26 to 376 (351 residues), 227 bits, see alignment E=1.3e-70 PF00890: FAD_binding_2" amino acids 26 to 246 (221 residues), 28.3 bits, see alignment E=2.7e-10 PF13450: NAD_binding_8" amino acids 28 to 63 (36 residues), 22.8 bits, see alignment 2.3e-08 PF13738: Pyr_redox_3" amino acids 188 to 246 (59 residues), 30.1 bits, see alignment E=7.7e-11

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to bpy:Bphyt_4572)

Predicted SEED Role

"Lysine-specific permease" in subsystem YeiH

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD31 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BPHYT_RS22700 FAD-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MQSFYEATVTRSSAYAPLAGRRAANVCVIGGGLAGLSTALGLAERGVADVTVLEARQVGF
GASGRNGGFVFGGYSLDCADLLKTLGAVRARELYTLTTDAVDLMRKRIARYHIDCDATDA
GVILANWFDEPARLESQRRLMRDSFGVEWEPVAAQQLASQLKTRRYHSGLFERNAFHFHP
LKYVLGVANAAAHAGVQIHEDSPVVRLERDGAGFVVHTQHGVLDARHVVMAGGGYARRVY
PRVERAVLPIATYVMATEPLGARLQDAIDTRAAIYDTRFAFDYYRPLPDTRILWGGRISV
RDREPEVIARLLRRDLLKVYPQLHGVRIDYAWGGLMSYARHKMPQIGRSADGVWYAVGFG
GHGMAPTTVSGELLAAAIAGERPVPEAFASFGLTPAYGALGLAAAQLTYTAMQTRDALAA
RRRPAV