Protein Info for BPHYT_RS22625 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 27 to 238 (212 residues), 72.5 bits, see alignment E=3.4e-24 PF07690: MFS_1" amino acids 31 to 393 (363 residues), 79.8 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4557)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD16 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS22625 MFS transporter (Burkholderia phytofirmans PsJN)
MQATNLGGAQAVTPRPLGRSDYKTLGLAALGGALEFYDFIIFVFFAPAIGQLFFPAAMPD
WLRQVQTFGIFAAGYLARPLGGIIMAHFGDLFGRKRMFTLSVLLMSVPTLMMGLLPTYTS
IGVLAPVLLLLFRVMQGAAVGGEVPGAWVFVSEHVPQRHIGYACGTLTAGLTAGILLGSL
IASAVNRNFAPAEISAYAWRIPFLVGGVFGMFSVYLRRWLHETPVFAELKQRKAIAAEVP
LKAVLRDHGRAVIVSMLLTWMLSAAIVVVILMTPTLLQKQFHIAPATALLANCVATLCLT
IGCVMAGSIAGRIGAGRTIFIGGVALAVTYYVMFQQLAVDTSALVPLYAVAGLFVGVIGA
IPFVMVKAFPPVVRFSGISFSYNVAYAVFGGLTPIAVSLMMKSNPMAAPMYVGAICILGA
LTTLFIKDAPQKH