Protein Info for BPHYT_RS22445 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details PF00892: EamA" amino acids 145 to 276 (132 residues), 37.4 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4521)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGT3 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BPHYT_RS22445 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
METLVVLLVLLSALLHATWNAFLHLSEDRIWLLGMMAMPYIAVSAVGVIVLPMPAPAAWP
YIFASVVLEFGYLLALIRAYKSGDFGQIYPIARGLSPMLVFVGALVFAHEALKPLAAIGV
ALVSLGIVSLAFRRGMRFSGESVPFALLTGFFIATYSVVDGIGARLAGNGLSYIMWVYLI
WNIPQFLLAWHWRGGAKGLFIGRAMVLKGIAAGLLALSAYCLIIEAYRYLPIAMVSALRE
MSSIFAVLIGWLFMREKLTARRIVACALVTLGAVLIRV