Protein Info for BPHYT_RS22365 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details PF16927: HisKA_7TM" amino acids 10 to 215 (206 residues), 34.5 bits, see alignment E=2.1e-12 PF02518: HATPase_c" amino acids 354 to 457 (104 residues), 79.8 bits, see alignment E=2.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4505)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDY1 at UniProt or InterPro

Protein Sequence (480 amino acids)

>BPHYT_RS22365 membrane protein (Burkholderia phytofirmans PsJN)
MYAIPTACVSAMFVVFGLYVLITQGATRLFTPFILMCVSTFAWQGAWTLLFQTDNPHTAD
LLVRGGYLFILFLPTTFYHFVTEVAAQRREQPILLASYGLCFVLAILLPGNEVVAGYQHF
FFGYYPVAGPLHPLHVVQTVLLAGRSAQLLLAARQKAEGDARRRLDLCLASLCLYSFAAM
DYAVNYGFGFYPPGVLFIGLSLGLLAITIVRYHLIHPYAVAATIAHEISTPLATIGMHAD
EIASVWGHVFKGYRTAVTHGLYEDHDEVGQSERIGQLATAIRREVSGTSAMVEMALASFT
LDRLDRGDFSRHSVHQCVMSTLERYPFSGDERERVTVMPIDLAMSFSGSDTVVVFVLFNL
LKNALHAIRVGGDGAITISAVQDQDFCVLQFRDTGPGIAPDVLPYIFDAFFTTKRHGSGA
GMGLAFCRRATELLGGSIECSSIRGIHTTFTVRLPAPDTPADRALRKTPAQHSPRWSQGQ