Protein Info for BPHYT_RS22335 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details PF02683: DsbD" amino acids 8 to 205 (198 residues), 52.5 bits, see alignment E=1.5e-17 PF00578: AhpC-TSA" amino acids 323 to 427 (105 residues), 46.4 bits, see alignment E=9.2e-16 PF08534: Redoxin" amino acids 323 to 434 (112 residues), 52.8 bits, see alignment E=1e-17 PF13905: Thioredoxin_8" amino acids 330 to 425 (96 residues), 33.9 bits, see alignment E=8.2e-12 PF17991: Thioredoxin_10" amino acids 480 to 626 (147 residues), 183 bits, see alignment E=1.1e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4497)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDY5 at UniProt or InterPro

Protein Sequence (626 amino acids)

>BPHYT_RS22335 cytochrome C biogenesis protein (Burkholderia phytofirmans PsJN)
MLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRSGLPLLAGMALTFALVATLAAVG
GGWVTQANQYGRWVAIALLAIFGLTLLFPRFADHLMRPLVSAGNRLSNFAQTDGQQVRAG
SSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGTTLLLVAYAAGAATSLAVALLIGG
KVFTAMKRSLGAGEWIRRGIGALMLCGVAAIALGFDTGVLARVSTVATGGLEQKLVDKLS
PNAAPGKAPVAGNAADASGGAMMSVNAASQSTAGADADSTAVNAAQGGAMMRTAVAAEAA
PLPVEGVLPPLDGAVQWLNSPPLTTQDLRGKVVLVDFWTYSCINCLRSLPYVKAWAQKYK
DQGLVVIGVHAPEFAFERNIDNVKKATHDLGVDYPVAIDNNYAIWRALNNQYWPAHYFVD
AKGQIRYHHFGEGDYAGSEKVIQQLLTEAGHANASKVALGIANGGAQGVQAAADNADMQS
PETYVGYQRAENFASPGGEVADKTHTYVAPSQPGVNDWGLAGSWNVGAEHATLAASSGRI
VYRFHARDLHLVLGPGKDGKPVRFRVSVDGAAPGASHGTDVAADGSGTVTGQRLYQLVRQ
TGEVGDHTFSIEFLDPGVQAFAFTFG