Protein Info for BPHYT_RS22210 in Burkholderia phytofirmans PsJN

Annotation: metal ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 29 to 260 (232 residues), 193.4 bits, see alignment E=1.8e-61

Best Hits

Swiss-Prot: 35% identical to PLPB_MANHA: Outer membrane lipoprotein 2 (plpB) from Mannheimia haemolytica

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4472)

MetaCyc: 35% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7U6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BPHYT_RS22210 metal ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MKARRFATAVLLVAASMVQHVQAAAPQVIKVGVSAGAHAEIMDEVRRVAASRGLTLDVVV
FDQPERIDAALAAKQIDAASFEDEPRFEAQCKQHGFPLTSVATTVTFPIALYSRKLTNLG
QLQRGATIAIPNDREGTARALILLQNFTLLTFRDTAGLHATLADITSNRLNLQIRQVPRA
RLFDTLNSVAFAVIDSDDAARAGLYPARDSLGLEDARSPYANVLTVRDAERTQPWVAQLV
AAYHSDDVAHFILTRYQDSVRRPW