Protein Info for BPHYT_RS22200 in Burkholderia phytofirmans PsJN

Annotation: cardiolipin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 259 to 276 (18 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 57 to 416 (360 residues), 321.1 bits, see alignment E=7.4e-100 PF13091: PLDc_2" amino acids 75 to 179 (105 residues), 34.4 bits, see alignment E=1.9e-12 amino acids 261 to 386 (126 residues), 111.4 bits, see alignment E=2.8e-36

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to bpy:Bphyt_4470)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE47 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BPHYT_RS22200 cardiolipin synthetase (Burkholderia phytofirmans PsJN)
MLTIPITAFVTLVIILVIANLSSGEKKIEHKIDRLYASDDPQFLRSMGLLLGPPVISGNR
FEMLLNGDHIFPSMLEGIRSARRTITFETFIYWSGEIGEQIAQALADKAREGIAVHVLLD
WVGSSKMDKRYLDLLRDAGAEVIQYHKPHWTGLGRMNDRTHRKLLVIDGHVGFTGGVGIA
PEWTGHAQNEKHWRDTHFRVEGPVVGHMQAVFMDNWVKATGNVLHGPNYFPDVEPMGEGL
AHMFSSSPSGGSDDMQLMYLMAITAATHSIHLASAYFVPDKLTINAIVEAAKRGVKVQII
MPGKRIDTHTVREASRACWGDLLRAGVEMYEYQPTMFHCKLLVVDEYLVSVGSTNFDSRS
FKLNDEANLNIYDRDFAKQQTAVFADDIKKSQQITLEAWMHRPLMEKLIEKFVSLLDTQL