Protein Info for BPHYT_RS22120 in Burkholderia phytofirmans PsJN

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 57 to 73 (17 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 352 to 381 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 5 to 356 (352 residues), 182.4 bits, see alignment E=2.5e-57 PF01740: STAS" amino acids 395 to 479 (85 residues), 31.2 bits, see alignment E=3.1e-11 PF13466: STAS_2" amino acids 406 to 479 (74 residues), 32.3 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 42% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4452)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE36 at UniProt or InterPro

Protein Sequence (482 amino acids)

>BPHYT_RS22120 sulfate transporter (Burkholderia phytofirmans PsJN)
MPGIKSNVLAGLTSSFALVPECIAFALVAHLNPLMGLYGAFSICAITALFGGRPGMISGA
AGSMAVVIVALVVQHGAQYLLATVILSGILMVLFGALRLGKLIRMVPHPVMLGFVNGLAI
IIAMAQLAHFRQSTPQGEQWLHGSALLLMCGLVALTMAIVYLLPRLTRAAPPALVAIVGV
GLFTQWLHVPTRTLGDMAHIAGGLPGLHMPDVPLNLDTLHVVLPYAVLMAVVGLLETLLT
FNLTDEITETRGQPNRECLALGAANIASGLFGGMGGCAMIGQTMINLNSGGRSRLSGIVS
GVMILMYILFLSPLIERIPLAALVGVMFVVAQQTFAWGSLRVLGKVPRNDALVIVAVTII
TVFSDLAIAVLCGIVIAAFNFAWQHAREIHAHVEDRAGDKTYAPRGTLFFASTTRFHELF
DPVKDPARVTVDCRDLLLADHSALAALQGLVERYRKAGKELRMKNLSDRNKRLLSRAGIA
LA