Protein Info for BPHYT_RS21795 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 385 to 416 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 11 to 379 (369 residues), 180.7 bits, see alignment E=2e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4387)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF93 at UniProt or InterPro

Protein Sequence (519 amino acids)

>BPHYT_RS21795 membrane protein (Burkholderia phytofirmans PsJN)
MNLREQFASFPRDMFAGTVVFLVALPLCLGIANASGVDPIAGLLSGIIGGLVVALLSGSH
LSVSGPAAGLVVIVVDGMTRLGSFSSFLIAVLLAGAMQFGFGLLKAGRFAAYVPSSVIKG
MLAAIGLLLIIKQAPLAAGLADGSASVTSAMSGTVVTPFGAMSVAACAIALVSLAILASW
ETRAARRFAFVRHVPAPLAVVLFGIGLTLLLDFVAPAFAPPLEHRVSLPSLASFAALDKV
FNWPELTHLLKPDVWRLAMTIAIVASLETLLCLEAVEQIDPKKRPVQPDRELKAQGIGNI
VAGAIGGLPITSVIVRSSANVEAGAQSRWSAVVHGALLLVSVFALTAVINLIPLASLAAI
LIFTGLKLAKPSMFADAARQGFARFAPFVVTIAAVLLTDLLMGIVIGIVCSVAFAIHAHM
RRPITMAQHDDHFLLCLRKDVSFLAKVSLKEHLKTIPDRATVILDGSRADFIDPDARELI
DEFVKNAPARGIQVECRQLEKVVEERVGLRGFGALLRRQ