Protein Info for BPHYT_RS21725 in Burkholderia phytofirmans PsJN

Annotation: taurine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13379: NMT1_2" amino acids 30 to 248 (219 residues), 65.4 bits, see alignment E=1.9e-21 PF04069: OpuAC" amino acids 33 to 253 (221 residues), 59.3 bits, see alignment E=1.2e-19 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 35 to 337 (303 residues), 408.7 bits, see alignment E=8e-127 PF12974: Phosphonate-bd" amino acids 55 to 201 (147 residues), 43.3 bits, see alignment E=8e-15 PF09084: NMT1" amino acids 67 to 252 (186 residues), 67.3 bits, see alignment E=4.6e-22

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_4373)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF79 at UniProt or InterPro

Protein Sequence (344 amino acids)

>BPHYT_RS21725 taurine ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MRPWFQWTARCVLSLVCAATACFATTPAHAEDKEITIAYQQIVDPWVVGIANGSIEKATG
YKINWRQFESGAKVATALASGDVKVGVIGSSPLAAAVSQGLDLQLFWILDNINQAEAMVV
RNGSGITKPADLKGKTIGVPFVSTTHYHTMFALQHWGINPSDLKILNMQPNQIVAAWSRG
DIDAAYVWDPALAELKKSGKVLITSGDLSKLGKPTFDGIAVDRKWGEEHKDFMAKLVKAI
ADADQQYRSNPSQWNASSPQAAAIAKMIGGSPADVPASLALYAFPTLSEQASAQWLGGGT
TSRAALALKDTSEFLKSQKQIGTVLPDYSKFVTPAYAEAAAQLK