Protein Info for BPHYT_RS21695 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details PF01925: TauE" amino acids 10 to 242 (233 residues), 61.3 bits, see alignment E=5.7e-21

Best Hits

Swiss-Prot: 69% identical to TAUE_CUPNH: Probable sulfite/organosulfonate exporter TauE (tauE) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4367)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF73 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BPHYT_RS21695 membrane protein (Burkholderia phytofirmans PsJN)
MIVQKLLPLLALMGVASYFQTITGFGLSMIVIGAASGLDLAPVTSLAALLSLVTLANSAT
ALPGKLHHIDWRAVGAATLGILPSVVAGVLVLDLLSNAASSMLQLLLGAVVLYGGLSAAL
RPTPLACRSGNRSFFVSGLFGGLLSGMFGVSGPPLIFQFYRQPLSLVQIRYALIVIFTVT
STIRTMFSAYLGQLDADLWMQAAFAVPVVALMTLVARQYPPPLSSVMTRRIAYAILVVIG
GSLILHALQQLLR