Protein Info for BPHYT_RS21490 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 378 to 395 (18 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details amino acids 470 to 487 (18 residues), see Phobius details amino acids 521 to 540 (20 residues), see Phobius details amino acids 560 to 583 (24 residues), see Phobius details amino acids 595 to 617 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 289 (281 residues), 119.2 bits, see alignment E=9.5e-39 amino acids 349 to 606 (258 residues), 128.5 bits, see alignment E=1.4e-41

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_4327)

Predicted SEED Role

"putative permease component of branched-chain amino acid transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF33 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BPHYT_RS21490 ABC transporter permease (Burkholderia phytofirmans PsJN)
MLSNLLVQLVNGLADASTLFLVAAGLSLIFGVTRIVNFAHGSFYMFGIYVAYSIASRFGH
TTGGFWLSVLAAALVVAVLGALVEMVVLRRIYQAPELFHLLATFALVLIFRDAALWLWGP
EDLFGPRAPHLAGAVDFLGHPLPTYDIALIVIGPVVLLLLWYALTRTRWGTLVRAATQDR
EMLGALGINQAWLFTGVFFVGAFLAGLGGALQGPRMSANLSLDLETIGNAFVVVVVGGMG
SIPGAFIAALIIAEIKALCIGIGHVTIFGVGLSLSRFTLVAEFVVMAVVLVVRPWGLLGR
ASAAVRGMAAPETPLRPAGKRLKWLAAIALLVLVLAPLAANAFPYMPVLLVEILIAVLFA
TSLHFIMGPGGMHSFGHAAYFGLGAYGAALFLKVLNLPMEAALLLGPLLAVAGALVFGWF
CVRLSGVYLAMLTLAFAQIVWSVVFQWDDVTGGSNGILGLWPSNWLSSPVAFYYVTLVCA
VIGVWLLRKMLFSPLGYAMRASRDSVLRAEAIGIDVKRVQWAAFVIASLFCGLAGSLYAF
SKGTISPEVISVSRSVDGLVMVLLGGLQTLTGPIVGAAVFTWLQDTVARQTDYWQALLGF
AILLLVIAFPQGIVGFIRERFGDDSADSADKSAVSPSRRAAIKEGL