Protein Info for BPHYT_RS21265 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 120 to 302 (183 residues), 42.5 bits, see alignment E=3.2e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_4282)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEY8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BPHYT_RS21265 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTTDHRATQPSWSASTSNDHDDGAREPERRTGHTRQRTSVPGRIWRVLVWGAMVFFLVNV
VLLIATVAVNSIATRWFGTLLPQGFTLHWYAQAWSDFQLASVLWVTVEVVGAVVLLSVLL
GVPAAYALARVQFPGKRIAMLIFLLPLMVPPVTYGIPMATVMYKVGLAGTLSGVILANLV
PALPFVILVMTPFIEQIDPNLEAAARIFGANTFRYFRYVLLPLLVPGMLAAGLLVLVRTI
GMFELTFFTAGPATQTLVVALYYAVFSTGVRAPQSIDAMAMIYMAITLIWVLIALQFVSP
TQIVSRVKEQKR