Protein Info for BPHYT_RS21260 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 273 (188 residues), 42.9 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4281)

Predicted SEED Role

"ABC transporter, membrane spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEY7 at UniProt or InterPro

Protein Sequence (292 amino acids)

>BPHYT_RS21260 ABC transporter permease (Burkholderia phytofirmans PsJN)
MNTPTLSPPLVPRDAKAWLVAPALLFVVALFIYPFAYGLMLSFRPMNGGSLWANYLAFFT
DTSMWPTIFVTLKLSVPATLINVGVSVPVAFALRRYSRYQKFVTTLLVIPVTLGTVLIAD
GMLTYFGPNGWFPQALQGLHLYTREVRLTHNFWGVLISLIVSGFPFAFLLTLSYVTGIDP
TLAAAAATLGASPWQQFRRIYLPLLVPGLTMAACLSFVQAFSVFPSAVLLGAPAGPTRVM
SIAAAEAAFESYDYSLASAIAMVMGFVQLLVVAALLGARRFFYSGPTTGGKG