Protein Info for BPHYT_RS20690 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 64 to 105 (42 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 326 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 321 (264 residues), 173.7 bits, see alignment E=2.2e-55

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_4159)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEM1 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BPHYT_RS20690 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTVETSLPTLQNEPPKNAKPLGTRLGLSNYLGLLGALLGMIVLFSLLSSHFLTYDTFSTI
ANQIPDLVVMSIGMTFVLIIAGIDLSVGSVLALGAALTSVAALQWHWPALPAALLGMAGA
TLTGCVTGAITVAWRIPSFIVSLGVLEAARGLAYQLTNSRTAYIGDAFDFLSNPVAFGIS
PAFIIAIVVMVAAQFVLTRTVFGRYLVGIGTNEEAVRLAGVNPRPYKIAVFAMMGLLAGL
ASLFQISRLEAADPNAGQGIELQVIAAVVIGGTSLMGGRGSVTSTFFGVLIISVLAAGLA
QIGATEPTKRIITGAVIVVAVVLDTYRSRRRAG