Protein Info for BPHYT_RS20680 in Burkholderia phytofirmans PsJN

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 38 to 281 (244 residues), 82 bits, see alignment E=8e-27 PF13407: Peripla_BP_4" amino acids 40 to 300 (261 residues), 193.3 bits, see alignment E=8.6e-61 PF13377: Peripla_BP_3" amino acids 174 to 265 (92 residues), 36.6 bits, see alignment E=7.3e-13

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_4157)

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEL9 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BPHYT_RS20680 LacI family transcriptional regulator (Burkholderia phytofirmans PsJN)
MIRHFLPARRRAIAAGAAFLAVSILPMPAAFAQAAHKPKVALVMKSLANEFFLTMETGAK
DYQKQNPAKFDLVTNGIKDETDTANQIRIVEQMIVSKVDALVIAPADSKALVPVLKKAVD
AGIIVVNIDNKLDNDVLKSKDLNIPFVGPDNAKGAQKVGDYLAKHLKSGDNVGIIEGVTT
TTNAQQRTAGFKQAMAAGGMKVVALQSGEWEIDKGNAVASQILNANPDVKALLCGNDNMA
IGAVSAVRAAGKAGKVQIVGYDDINAIKPMLKDGRVLATANQYAAKQAVFGIDTALKALS
EHKKQSELSGVVETPVDLVTK