Protein Info for BPHYT_RS20320 in Burkholderia phytofirmans PsJN

Annotation: CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 PF02629: CoA_binding" amino acids 19 to 109 (91 residues), 33.9 bits, see alignment E=1.1e-11 PF13380: CoA_binding_2" amino acids 20 to 144 (125 residues), 89.1 bits, see alignment E=7.2e-29 PF13607: Succ_CoA_lig" amino acids 165 to 303 (139 residues), 140.9 bits, see alignment E=5.8e-45 PF19045: Ligase_CoA_2" amino acids 315 to 469 (155 residues), 34.1 bits, see alignment E=7.2e-12 PF13549: ATP-grasp_5" amino acids 502 to 716 (215 residues), 233.3 bits, see alignment E=5.6e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4084)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEE7 at UniProt or InterPro

Protein Sequence (723 amino acids)

>BPHYT_RS20320 CoA-binding protein (Burkholderia phytofirmans PsJN)
MNPATHDAGALDIGRLVEPRSIAIIGASNDPKSISGQPMRFLMQHGYQGTLYPVNPKYAQ
IDGVACHDSIAALPSTPDLALILVAARRVPDMLRQCGEKGVGFAIVYSSGFAEAGEAGAA
LQRECADIAKAHGIRVIGPNCQGFVSTGANVYAGFGAPFGVAYRRGGLSLISQSGGFGCA
LLLMADELGIGLRHFITTGNEADVSLLDLVNACIADPHTSLIATYIEGLKDAGRLVDMAN
RALDAGKPLLAWKVGNTADGAKAAASHTANLGGASALYRTAFRQTGVIEVSDVADLGDYA
RAFEAGRLPRGKRIAVVTLSGGAGILITDACAERGMSVPALSAATLERLKPIVPAFASLN
NPIDLTAGILAEPKIFADALQIIADDPNIDAIAIMAAAASGEVAQAMATAIVRVYGSIDK
PLMLAWNARRDMAGEAYETIEAHGVPLYATPVRCGRAFAALADYAQARRARAEARDPMPR
ALRRYDVEHARALLVDIQGKHGDLDLTEHASQALLRDYGIDVPKSGLAQNRDQACALARA
IGFPLVIKVQSPDIAHKTEAGAVRVGIRDEATLAAAFDEIVGNAHRHVPHARIEGVLVQE
EIRDALEMIVGIENDASFGPAVMCGLGGIYAEVLKDVSFRLAPVTHADAHAMIRELRSFA
MLDGARGKPPGDIEALVETIVALSTMALDQRASLRELDINPLFVLPAGKGVRAGDALARL
LPR