Protein Info for BPHYT_RS20235 in Burkholderia phytofirmans PsJN

Annotation: iron ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details amino acids 485 to 503 (19 residues), see Phobius details amino acids 510 to 533 (24 residues), see Phobius details amino acids 539 to 555 (17 residues), see Phobius details amino acids 562 to 580 (19 residues), see Phobius details amino acids 603 to 629 (27 residues), see Phobius details amino acids 645 to 666 (22 residues), see Phobius details amino acids 672 to 692 (21 residues), see Phobius details PF01032: FecCD" amino acids 37 to 343 (307 residues), 197.3 bits, see alignment E=1.7e-62 amino acids 388 to 691 (304 residues), 268.4 bits, see alignment E=3.6e-84

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to bpy:Bphyt_4067)

Predicted SEED Role

"Ferrichrome transport system permease protein FhuB (TC 3.A.1.14.3)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TED0 at UniProt or InterPro

Protein Sequence (702 amino acids)

>BPHYT_RS20235 iron ABC transporter (Burkholderia phytofirmans PsJN)
MTTLAARKRLSRSTQAMDSYRAPVKSRVTTIGAALVALIVIVAVMRLAPGFRTWLAAPTG
SDAAQLAGILLFDLSVPRILAALVAGGCLAVAGTLFQSLTRNPLASPDLLGITGGAQLGL
LAAMLVPSLAGVASVPLLFACGLGAAACVAAAAGGWRATPLRLVLAGSVCMLLFSALTTL
ILAFFEQSIVGVSLWASGSLYQPGAAGLKIAASWLVLPLIALPFVIRPLDPLALGDDAAA
AAGVRVDATRLAAMVVAVGFASVAVSVAGPLSYVGLIAPNLLRQMRGAKASRLAALVPLS
ALVGGALVLVTDSAVQALDLDATLSTGVAIAFVGTPLMLAMIRSGAAWSGALHAGQERAV
ARAGTRFVRAIDARPWPLTASALVLLGVVLVCAGASFGPTTIGAQRWLAAFDHRDELARM
LLDLRLPRLICALLAGALLAASGVLMQSIVRNPLAGPEVLGVTQGAGLATLAALVMWPLA
NHSTLAAASLAGGGITLALTLLLNRRHRYAPLAVALTGIVIGTLWTTLSQWLITQQSVQP
ARFVVWLVGGTYGRSWGEVTTLLPWCVLALPVFALLARPLDLLALGDDQAASLGLPIGVL
RPLVLTVATLAACAAVAAVGPVGFIGLMAPHLASMLGARAHRTRLWLAAACGALVLVVAD
IAARTLLAPREIPAGVLTALIGAPYLLALLIVEARREKRGKR