Protein Info for BPHYT_RS20180 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF02563: Poly_export" amino acids 56 to 147 (92 residues), 82.5 bits, see alignment E=1.9e-27 PF10531: SLBB" amino acids 154 to 203 (50 residues), 39.2 bits, see alignment 5e-14 amino acids 238 to 287 (50 residues), 15.9 bits, see alignment 9.5e-07

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to bpy:Bphyt_4055)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEB8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS20180 sugar ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MRMPTSASLPTGNSNAQGQQADLQIPIVDINTALIKKLRDASDQTSTDQTRELSGQTGPY
TLGVGDVLQITVWDHPELAAALGNQNQNNSRPFDPAQGFVIDNGGNIQFPYAGSIHVAGL
RVEQAQQAVYAELSKIFIKPQLTVRVTSFRAKQIYVDGEVRTPGAVPVNDIPLTLYEAIN
RAGGFSPAADQSRMILVRNGVSYRLNLSKMLESDQNPSGIMLKNGDLLRVVSRDDNGVFV
MGEVNKPVTALPMKSGKLTLSDALSQAGSLNTASADAAQLYVIRGSTDSQAEVFHLDAHS
PVSMILANQFELQPKDVVYVDGNGLVRFSRVLSLLLPAINAGLTTAIVTK