Protein Info for BPHYT_RS20170 in Burkholderia phytofirmans PsJN

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details amino acids 549 to 569 (21 residues), see Phobius details TIGR01005: exopolysaccharide transport protein family" amino acids 9 to 731 (723 residues), 457.1 bits, see alignment E=1.1e-140 PF02706: Wzz" amino acids 10 to 106 (97 residues), 64.6 bits, see alignment E=1.7e-21 PF13807: GNVR" amino acids 387 to 466 (80 residues), 104.3 bits, see alignment E=5.1e-34 TIGR01007: capsular exopolysaccharide family" amino acids 525 to 729 (205 residues), 111.8 bits, see alignment E=3.2e-36 PF01656: CbiA" amino acids 547 to 721 (175 residues), 31.2 bits, see alignment E=4e-11 PF13614: AAA_31" amino acids 552 to 669 (118 residues), 43 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 45% identical to EPSB_RALSL: Putative tyrosine-protein kinase EpsB (epsB) from Ralstonia solanacearum

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4053)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.2

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEB6 at UniProt or InterPro

Protein Sequence (740 amino acids)

>BPHYT_RS20170 sugar transporter (Burkholderia phytofirmans PsJN)
MKNQFSRDEDEIDIRALIDVIFKNKKLIIAVTIVCTLIGVMYAFLATPIYRGDITVQVED
NSDLAGAAAGNLMSGLTSLFDIKSTDDGEMQILDSRLVTANMVDELRLYIDARPKYFPLL
GAFIAKHRTSLSQPGILGVGGYAWGSESIVVDQFDVPGEFEEDKFSVTTLGNNRYRLSGS
DLNADVVGVVGVPLLANTSSGPIKLLVSRLSSRENAQFELRRFSRIQVLEQLRKDLVITE
MGKDQSGVIGVTYDDQDPARAAAVLNKIAENYVAQNADRKAAAAEKSLVFLKSQLPDVER
SLRLAEDRLNAYQNRHKVVDLSEQAKAVLGQAVEAQSSLFQLEQKRKELATIYSAQYPAV
LALDQQIAAARAHIDNFNESIQRLPDDQQNIVRLNRDVTVQTSLYVGLLNSVQQLQLATA
SKIGNVRVIDHALVADKPTKPKKALVIALAAVIGLFGGIGFALARSTLFGGLTDPMDIER
DLSLDVIATIPLSDTQRQLTRVRERGGRRGPSILALARPQEPAVEAIRSLCTALQFALLE
NPKNNVILMTGPSVGIGKSFTSANLAALLGMSKKRVLLMDVDLRRGHLAAEFDVSGKVGL
SNVLRDDMPLEAAIIKDVSPNVDFLATGPLMAQPVELLSSGGIAKILADVSGRYDIVLLD
APPVLPVTDATVFAPFAGIVLLAARSGMTSSGELLESAKRIERVGAKITGIVFNGFKPSL
RSAQYGDYGGYAYLSNASDT