Protein Info for BPHYT_RS20155 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 290 to 303 (14 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 364 to 397 (34 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4050)

Predicted SEED Role

"FIG00464760: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEB3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BPHYT_RS20155 hypothetical protein (Burkholderia phytofirmans PsJN)
MNASIAFVPSYRESQLTGWHSVGAWAISFSYLLFCISDTLLSLEMDGSQLVKLGAFVLLA
VAILLRPRFHKLIALIVPFMLALYIAMWRAFNVNAGGEEFLRFLAPMAITVAIFAYRSKL
APVLFMFFAVVLSNDLFQCYFYLAYGLKLPLFLPVKFDSGLYLRAQGWIGFFSEFSFINF
CAFLVCRHYRPTRRSQRAAWIFLTFALLGVSFKIFATIAMYFIVARKLTVRSFIAALSAI
GLVLFALMAGLLDSLIKIAMTKISFYVVAGNSARAESYRVMFQSLMKGNIFGEGLGSFGG
PASVKYHSPLYSIYHFNWYGLGNTLTTTDTFYPHLFVELGVLGAILWLAFMLLYGQVSKR
RRVWLFLVGAFCFDNIFSMSFVSASYVFSALMLMYLFSDNGSLISRPPSAAGKRAGAMR