Protein Info for BPHYT_RS19990 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 43 to 476 (434 residues), 138.1 bits, see alignment E=4.2e-44 PF07690: MFS_1" amino acids 80 to 344 (265 residues), 75.4 bits, see alignment E=4.2e-25 amino acids 328 to 470 (143 residues), 41.8 bits, see alignment E=7e-15

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to bpy:Bphyt_4015)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE80 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BPHYT_RS19990 MFS transporter (Burkholderia phytofirmans PsJN)
MASLPIDASGASPHSSAGAPALTPGVNARIDRLPATRAVWMLVLLLSIGGWFEFYDLFFT
AYVGPGLVKSGVYSTTTASFFGVSGLGAFVAASFAGLFIGTFFLAGMADRYGRKTVFTVS
LLWYSAATLIMALQSTAPAINLWRLIAGIGVGVELVTIDTYVSELVPKHLRGRAFAFVHL
VQYTAVPSVAFLAWWLVPRTPFGLDGWRWVVIIGALGAVVVWAIRRRLPESPRWLAQQGR
AAEAEQVLQALEAKVAAQYGKPLPPAVPTVEPATTKAAFREIWQPPYRKRAITMLVFNLF
QAIGFYGFASWVPTLLVSKGVTITHSLLYSFVIAASNPFGPLIGMAIADRIERKTLIVLS
ALGIAVFGSLFAMQTSPAMLMTLGVLITLSGTLLSVGYHAYQTELFPTRLRARAVGFVYS
MSRLSAMFSGFMIAFALRHFGVSGVFALISASMVMVMGAIGIFGPRTNHRNLDEISH