Protein Info for BPHYT_RS19970 in Burkholderia phytofirmans PsJN

Annotation: tellurite resistance protein TehA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF03595: SLAC1" amino acids 8 to 305 (298 residues), 126.9 bits, see alignment E=5e-41

Best Hits

KEGG orthology group: K03304, tellurite resistance/dicarboxylate transporter, TDT family (inferred from 100% identity to bpy:Bphyt_4011)

Predicted SEED Role

"Tellurite resistance protein TehA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE76 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BPHYT_RS19970 tellurite resistance protein TehA (Burkholderia phytofirmans PsJN)
MNSNRGTIPVAFFGIAVGALAFANLWRVAIRLWHLPALAGDAITVAALAVWLVILVAYGQ
KWLTRADEARAEIQHPVQSSFAALAPISSLLAAQLLQPYAHTLALALYGVAVVAQLALGM
YLHGRLWQGGRKPELVTPAIYLPTVGASFVAGTASAAFGFHQLGELFFGVGLLSWLAIES
LVLHRAAVHEPLPDALRPVLGIQLAPPVVGGVTYLSLSSGTPDLFAMILLGYGLYQALLL
LRLLPWIRQQAFTPAYWAFSFGVAALPTMALRMVERGATGPVEYAAPVLFIAANVIIAIL
AVKTLSLLMRGKLIPATPVTGALSAPQTPAGSRIARAS