Protein Info for BPHYT_RS19595 in Burkholderia phytofirmans PsJN

Annotation: general secretion pathway protein GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 27 to 678 (652 residues), 678.7 bits, see alignment E=3.6e-208 PF21305: type_II_gspD_N0" amino acids 27 to 96 (70 residues), 88.8 bits, see alignment E=2.6e-29 PF03958: Secretin_N" amino acids 124 to 185 (62 residues), 53 bits, see alignment 4.7e-18 amino acids 187 to 257 (71 residues), 52 bits, see alignment E=1e-17 amino acids 264 to 407 (144 residues), 53.2 bits, see alignment E=4.3e-18 PF00263: Secretin" amino acids 499 to 668 (170 residues), 166.9 bits, see alignment E=4.8e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to bpy:Bphyt_3936)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7P2 at UniProt or InterPro

Protein Sequence (786 amino acids)

>BPHYT_RS19595 general secretion pathway protein GspD (Burkholderia phytofirmans PsJN)
MALRRVATALLVAGLITAQTAQAQVTLNFVNADIDQVAKAIGAATGKTIIVDPRVKGQLN
LVSENAVPEDQALKTLQSALRMQGFALVQDHGVLKVVPEADAKLQGVPTYVGNTPVARGD
QVVTQVFVLKNESANNLLPVLRPLISPNNTVAAYPANNTIVVTDYADNVRRIAQIIQGVD
SAAGQSVSVVQLKNANAIDIATQLNKMLDPGSIGSTDATLKVSVTADPRTNSLLIRASNG
ARLAAARTLAKELDTPTTMPGNIHVVPLRNADATKLAKTLRGMFGKGGDSGSSSNSNDAN
SFNQNNSGGIGGNNSTGSSGTPPLPSGGLGSSSLASPMGGSGSGGGYGAGGSNNGGFGND
KEKSDDNQQGGMIQADSATNSLIITAAEPVYRNLRAVIDQLDARRAQVYLEALIVELNSN
TSGNLGIQWQVANNSIFAGTNLQTGSSNSIVNLTAAAVAAGSTGGLAGALGNGTLQQGLN
IGWIHNIFGVQGLGALLQALSQTADANVLSTPNLITLDNEEAKIVVGTNVPIQTGSYSNL
TSATATSAFNTYDRVDVGLTLHVKPQITDGGILKLQLYTEDSAIVTGTNNAATNPAGPEF
TKRSIQSTVLADNGEIIVLGGLMQDNYQVSNSKVPLLGDIPWIGQLFRSEQKTRNKTNLM
VFLRPVIISDRGTAQAVTSNRYDYIQGVQGAYKQDNNLMKDNDDPVVPPMPIGPSQGGSP
AMNLFDLDKMRRQQLAPPPGNGGAVTNGAAATNGTAVQSSPATVGPAIQSSPVTVTPSTA
SPGVRP