Protein Info for BPHYT_RS19325 in Burkholderia phytofirmans PsJN

Annotation: glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 123 (121 residues), 149.4 bits, E=2.7e-48
• PF01597: GCV_H
  • amino acids 7 to 123 (117 residues), 148.9 bits, E=6.6e-48
• PF00364: Biotin_lipoyl
  • amino acids 47 to 79 (33 residues), 22.4 bits, E=9e-09

Best Hits

Swiss-Prot: 100% identical to GCSH_PARPJ: Glycine cleavage system H protein (gcvH) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to bpy:Bphyt_3881)

MetaCyc: 61% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See B2T7I7 at UniProt or InterPro

Protein Sequence (126 amino acids)

>BPHYT_RS19325 glycine cleavage system H protein (Burkholderia phytofirmans PsJN)
MSIPADLKYTESHEWVRTEADGTLTVGITDHAQEALGDIVFFEVQELGKTVTAGDTVAVI
ESVKAASDIYAPVSGEIIEANTAVADTPDSVNSTPYESWLFKIKPAADATQDRLIDADAY
TKSIGA