Protein Info for BPHYT_RS19135 in Burkholderia phytofirmans PsJN

Annotation: Rieske (2Fe-2S) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 229 to 242 (14 residues), see Phobius details PF00355: Rieske" amino acids 12 to 82 (71 residues), 53 bits, see alignment E=3.9e-18 PF00848: Ring_hydroxyl_A" amino acids 150 to 329 (180 residues), 43 bits, see alignment E=7.5e-15 PF19112: VanA_C" amino acids 154 to 314 (161 residues), 23.6 bits, see alignment E=8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3842)

Predicted SEED Role

"Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7E9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>BPHYT_RS19135 Rieske (2Fe-2S) protein (Burkholderia phytofirmans PsJN)
MTLDRILFEQYWHLACHRRELANDGDFIKFDGVSGEIVLFNDNGEIVAFDNTCPHRGARI
YTDEHGNRPATCGYHGWTYKNGTIIVPEKARFKSCDIDRARFNTFQVDWCGDFVFFAIKP
RMGLYEQLGKSADILENISFNVDRRLDLNRYDYECYWPLAVENALEPYHIAAVHAETLAT
LQLGDGQNVFDGANSIWYAPLGNARVVNQLARLRRLFNIDYQYEGYMSLYIFPFTMISST
YGYSYSLQNFFPARQGESRTRFTSRLYASNTLNENATRVLDSFFESTVRMNRKVFEEDHE
VCKLLPRDSWSMEPLKYASDLESKILHFRQ