Protein Info for BPHYT_RS18945 in Burkholderia phytofirmans PsJN

Annotation: flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 352 (345 residues), 402.8 bits, see alignment E=6.5e-125 PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 424.3 bits, see alignment E=1.9e-131

Best Hits

Swiss-Prot: 48% identical to FLHB_YEREN: Flagellar biosynthetic protein FlhB (flhB) from Yersinia enterocolitica

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to bpy:Bphyt_3804)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7B1 at UniProt or InterPro

Protein Sequence (403 amino acids)

>BPHYT_RS18945 flagellar biosynthesis protein FlhB (Burkholderia phytofirmans PsJN)
MAEDSDLEKTESATPRRLQKAREEGQIVRSRELSTFALLAAGFFGVWGMSGSIGEHLQGM
LRAAFSFDHAGAFETRRMMIGAGVASREGLYALLPILAFTGVAALFAPMALGGWQLSAKG
LEPKFDRLNPIAGLGKMFSINGPIQLGMSLAKTLVVGVIGGTAIWNRREEILALAMQPLH
LALANTVHLIAVCCGMTVAGMFVVAAMDVPYQLWQFHKKLRMTKEEVKREHRESEGDPHV
KGRIRQQQRAIARRRMMTNVPKADVVVTNPTHFAVALQYTDGEMRAPKVVAKGVNLVAAR
IREIAAENNVPLLEAPPLARALYHNVELNREIPGPLYGAVAEVLAWVYQLRRFKTEGGDV
PLAPTELDVPAELDKGGVSDDEAEQEAAETLNATNDDPSGASA