Protein Info for BPHYT_RS18780 in Burkholderia phytofirmans PsJN

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF14842: FliG_N" amino acids 4 to 103 (100 residues), 112.8 bits, see alignment E=1.7e-36 TIGR00207: flagellar motor switch protein FliG" amino acids 6 to 331 (326 residues), 373 bits, see alignment E=7.9e-116 PF14841: FliG_M" amino acids 115 to 185 (71 residues), 89 bits, see alignment E=3e-29 PF01706: FliG_C" amino acids 215 to 322 (108 residues), 133.6 bits, see alignment E=5.2e-43

Best Hits

Swiss-Prot: 59% identical to FLIG_SALTY: Flagellar motor switch protein FliG (fliG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to bxe:Bxe_A0165)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T778 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BPHYT_RS18780 flagellar motor switch protein FliG (Burkholderia phytofirmans PsJN)
MSAEGVMKSALLLMSIGEEEAAQVFKFLGPREVQKIGVAMAALKSVTREQVDEVLQEFVR
EAEQHTGMSLDSNEYIRSVLTKALGDDKAGAIIDRILQGSDTSGIEGLKWMDSAAVAELI
KNEHPQIIATILVHLDRDQASEIVACFTERLRNDVLLRIATLDGIQPAALRELDDVLTGL
LSGSDNLKRSPMGGIRTAAEILNFMSSNHEEGVIENVRQYDAELAQKIIDQMFVFENLLD
LEDRAIQLLLKEVESEALIISLKGAPPALRQKFLSNMSQRAAELLAEDLDARGPVRVSEV
ETQQRRILQIVRNLAEGGQIVLGGKAEDAYV