Protein Info for BPHYT_RS18645 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF06166: DUF979" amino acids 7 to 317 (311 residues), 410 bits, see alignment E=3.3e-127

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3745)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6W1 at UniProt or InterPro

Protein Sequence (318 amino acids)

>BPHYT_RS18645 membrane protein (Burkholderia phytofirmans PsJN)
MTLTITYLFWLLGVVLLVVGGMIVTDKDHPRRFTAGGFWILYALIFLIGDKLPPAVVGVL
VIVMALIAGFGGVTAGKPRVLSLEARKASAARLRNKLFVPALTIPVVTVIITLSASHLVF
GGMPLVEKANVTLIGFGIGCVIALAIACVMTRDTVGQSMKEARRLVDALSWAAVLPQMLG
MLGLVFSDAGVGKAVAHVTTAYISLDYRFIAVAVYCIGMALFTMVMGNGFAAFPVMTGGV
GVPILVGVFHGNPAVMVAIGMFSGYCGTLMTPMAANFNMVPVALLELPDKNAVIKVQIPT
ALSLLVVNILLLNFLMFL