Protein Info for BPHYT_RS18635 in Burkholderia phytofirmans PsJN

Annotation: LamB/YcsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 235 (233 residues), 319.4 bits, E=8e-100

Best Hits

Swiss-Prot: 100% identical to PXPA_PARPJ: 5-oxoprolinase subunit A (pxpA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K07160, UPF0271 protein (inferred from 100% identity to bpy:Bphyt_3743)

MetaCyc: 59% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

See B2T6V9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BPHYT_RS18635 LamB/YcsF family protein (Burkholderia phytofirmans PsJN)
MEIDLNADLGEGCGSDEALLDLVSSANIACGWHAGGANAMRDCVRWAVQKGVSIGAHPSF
NDPENFGRKEMDLPASDIYAGVLYQLGALSAIAQAEGGRIAHVKPHGALYNQAARDSKIA
DAIVSAVHDFDPSVAVFALANSGLVTAARNAGLVAVEEVFADRGYRADGSLVPRKEPGAL
LDDEDEVLTRTLAMIREQRVQAVDGQWVSLNAQTICLHGDGPHALAFARRIRGALQDAGI
EVHAAGAARA