Protein Info for BPHYT_RS18480 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 358 (341 residues), 191.6 bits, see alignment E=1.9e-60 PF00083: Sugar_tr" amino acids 48 to 185 (138 residues), 29.8 bits, see alignment E=3.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3710)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6S7 at UniProt or InterPro

Protein Sequence (393 amino acids)

>BPHYT_RS18480 MFS transporter (Burkholderia phytofirmans PsJN)
MGDKFSRAQKTAVIAGLFLAWAVGYADRILMSVALVPISKEFMLTAQEGGMLLSAFYFSY
AIMQLAGGWLSDKFGSRIVVVACVVMWSIFTGVTSLGWSFASLLVIRFMFGLGEGSFSPA
SSVTVAEVFPKKQRARAKSFLVSTTFLGSAVGSAIIAASVTKLGWRGAFDILSVVGFAVA
VILWFSLRGDKRARQKTDVERPRVAWKPVLQSPLAWKLTAVWFFTSALHVGVNSWMPTYL
MTSYHISLKHAGLALVVPNLIAFAGANTVGFFLDKLDKRFEKGCLVAGSALSTVFLVLMI
TTTQIWLLLTYWTLFSLSFNLVYATVFATPLRRVPEQLIGKTSGLMNFGGQLANSIFPAI
MGALITAANGAFFSAFYLLIGVGVLSVVAALVF