Protein Info for BPHYT_RS18440 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 16 to 30 (15 residues), see Phobius details amino acids 33 to 34 (2 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 165 (142 residues), 58.1 bits, see alignment E=7.7e-20 PF00083: Sugar_tr" amino acids 49 to 156 (108 residues), 24.3 bits, see alignment E=1.4e-09

Best Hits

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>BPHYT_RS18440 MFS transporter (Burkholderia phytofirmans PsJN)
MQRRPPVGVIHQIPRSVWILGYVSLFMDVSSEIVHSVLPMFLLASLGASAGTIGLIEGIA
EATAPIVKVFSGTLSDYLDNRKWLAVAGYSLGAISKPLFAVAPTIGIVVAARVIDRVGKG
IRGAPRDALVADVTPHHLRGAAFGLRQSLDTVGAFLEPLVAVVIMLVWADN