Protein Info for BPHYT_RS18035 in Burkholderia phytofirmans PsJN
Annotation: 50S ribosomal protein L18
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL18_PARPJ: 50S ribosomal protein L18 (rplR) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
KEGG orthology group: K02881, large subunit ribosomal protein L18 (inferred from 96% identity to bmu:Bmul_0265)MetaCyc: 56% identical to 50S ribosomal subunit protein L18 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L18p (L5e)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T735 at UniProt or InterPro
Protein Sequence (121 amino acids)
>BPHYT_RS18035 50S ribosomal protein L18 (Burkholderia phytofirmans PsJN) MDKTQSRLRRARQTRIKIAELQVARLAVHRTNTHIYAQVFSPCGTKVLASASTLEAEVRA QLADQTGKGGNVNAATLIGKRIAEKAKAAGIESVAFDRSGFRYHGRVKALADAAREAGLK F