Protein Info for BPHYT_RS17880 in Burkholderia phytofirmans PsJN

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR01353: putative dGTPase" amino acids 55 to 187 (133 residues), 196.2 bits, see alignment E=6.7e-62 PF01966: HD" amino acids 92 to 221 (130 residues), 56.7 bits, see alignment E=3e-19 PF13286: HD_assoc" amino acids 308 to 394 (87 residues), 98.5 bits, see alignment E=2.7e-32

Best Hits

Swiss-Prot: 73% identical to DGTL1_RALPJ: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (Rpic_3246) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to bpy:Bphyt_3596)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T703 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BPHYT_RS17880 deoxyguanosinetriphosphate triphosphohydrolase (Burkholderia phytofirmans PsJN)
MTDRRSDDVKHESAAGTAPISVPSQEALEAHLAPYAAHSAQSRGRRYPEAAPSARTEFQR
DRDRIVHSTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARSVARNLRVNEDLVEAI
SLAHDLGHTPFGHAGQDALNECMREHGGFEHNLQSLAVVDDLEEHYGAFNGLNLCFETRE
GILKHCSRENARRLGALGERFLEGRQPSIEAQIANVADEIAYNNHDVDDGLRSGLLTVEQ
LAEVELWQVHYETARSDFPQIEGRRLIHETVRRIINTLIVDLIDTTRLNLDLHAPASLDA
VRLSPALVAHSEETAAQAAALKRFLFKNLYRHYRVMRMANKARRVVAGLFDAFTDDPRLL
PPSYQSSDATQQPRLIAHYIAGMTDRYAVKEYQRLFVIDDN