Protein Info for BPHYT_RS17840 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 369 (348 residues), 141.4 bits, see alignment E=3.4e-45 PF00083: Sugar_tr" amino acids 49 to 192 (144 residues), 62.1 bits, see alignment E=4.9e-21 amino acids 218 to 412 (195 residues), 29.4 bits, see alignment E=3.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3588)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6Z5 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BPHYT_RS17840 MFS transporter (Burkholderia phytofirmans PsJN)
MPSLQWFTELTQRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIATWGMTKSEAGMIATSS
LISSAVGGWLAGILADRYGRIRVLQWTIATFALFTFLSGFTHSFWQLLTTRTLQGIGFGG
EWSVVTIMMAETIRSPQHRAKAVGTVQSSWSFGWAAAAIIYWAFFALLPEQYAWRACFWI
GLLPAAWIIYIRRNVSDPEIFLETRRARESGFDTSHFLQIFSGAHLKTTLLGSVLCTGML
GGYYAITTWLPTYLKTVRHLSVFNTSGYLIVLIVGSFTGYIVGAILCDKIGRRASFVLFA
IGSFVLGMFYTMLPITDGMMLALGFPLGIVVQGIFAGVGAYLSELYPNAIRGSGQGFCYN
LGRGLGSFFPILVGTLSQTMTLVKAMGIVAGSGYLLVIVAALCLPETKGKVLGTAQPTA