Protein Info for BPHYT_RS17595 in Burkholderia phytofirmans PsJN

Annotation: NAD(FAD)-utilizing dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 9 to 178 (170 residues), 30.4 bits, see alignment E=1.3e-10 PF01494: FAD_binding_3" amino acids 9 to 39 (31 residues), 24.2 bits, see alignment (E = 8.7e-09) PF03486: HI0933_like" amino acids 9 to 410 (402 residues), 383.1 bits, see alignment E=6.8e-118 PF00890: FAD_binding_2" amino acids 10 to 62 (53 residues), 22.8 bits, see alignment 2.2e-08 TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 410 (401 residues), 292.1 bits, see alignment E=6.2e-91 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 28.2 bits, see alignment (E = 8.3e-10) TIGR03862: flavoprotein, TIGR03862 family" amino acids 30 to 416 (387 residues), 540.5 bits, see alignment E=1.9e-166

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to bpy:Bphyt_3538)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ43 at UniProt or InterPro

Protein Sequence (421 amino acids)

>BPHYT_RS17595 NAD(FAD)-utilizing dehydrogenase (Burkholderia phytofirmans PsJN)
MSSSLRSARVAVIGGGPAGLMAAEALAQQGMQVDVYDAMPSVGRKFLMAGKGGMNITHSE
PLEPFLGRYGARREQIAPLVRTFDPDALRAWLHGLGVETFVGSSGRVFPADMKAAPMLRA
WLHRLREAGVRFHMRHKWCGWDTEAGHGVAHTLRFATPDGEQAVTFDAAVFALGGASWPR
LGSDAAWVPLIASRDVPIAPLRPANCGFDADWSPYLRERFAGQPVKPVAITLTDVDNKVH
NRQGEILLTETGLEGSLIYALSAAVRERILADGDVTITLDLAPGLALERVVAEVTRPRGS
RSMSSHLHGRIGISGVKLALLHEILSKEAFADAYGLAHAIKALPVRLTRARPIAEAISTA
GGIPFEALDEHLMIERLPGIFCAGEMLDWEAPTGGYLLTACFASGLAAGRGAAAYVRGAS
T