Protein Info for BPHYT_RS16990 in Burkholderia phytofirmans PsJN

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 458 (457 residues), 715 bits, see alignment E=2.1e-219 PF01225: Mur_ligase" amino acids 2 to 100 (99 residues), 74.2 bits, see alignment E=1.4e-24 PF08245: Mur_ligase_M" amino acids 109 to 295 (187 residues), 69.2 bits, see alignment E=7.5e-23 PF02875: Mur_ligase_C" amino acids 315 to 390 (76 residues), 35.9 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to bpy:Bphyt_3422)

MetaCyc: 61% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYS7 at UniProt or InterPro

Protein Sequence (464 amino acids)

>BPHYT_RS16990 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase (Burkholderia phytofirmans PsJN)
MHIHILGICGTFMGGLAVLARGAGHTVTGCDAGVYPPMSTQLEAQGIGLIEGYDADQLNG
LNADLFVIGNVVSRGNPLMEAILDRGLPYTSGPQWLGEHVLNGKWVLAVAGTHGKTTTSS
MLTWLLEDAGLNPGFLIGGVPLNFGVSARLTDSSFFVIEADEYDTAFFDKRSKFVHYRPK
TAVLNNLEFDHADIFPDLGAIETQFHHLIRTVPGIGRVVTNGREDALERVLTRGCWSEVE
RFGVQGGWQTLPAEDGVPVDERFAVYHNSARVGVVEWQVQGEHNRMNALAAIAAARHVGV
PPAQAARSLASFRNVKRRMEVRGSVDGVTVYDDFAHHPTAIDTTVAGLRARVGRHNTRIL
AVLEPRSNTMKLGVMKAQLPASLADADLVFGYGAPSGRDALGWNLGEALAPLGGKAQAFD
NLDALVKAVVHAARPGDQILVMSNGGFGGVHQRLLDALSARGAS