Protein Info for BPHYT_RS16680 in Burkholderia phytofirmans PsJN
Annotation: glutamine amidotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to Y1037_HAEIN: Putative glutamine amidotransferase HI_1037 (HI_1037) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K07008, glutamine amidotransferase (inferred from 100% identity to bpy:Bphyt_3358)Predicted SEED Role
"Glutamine amidotransferase, class-II" in subsystem Ammonia assimilation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2SYL4 at UniProt or InterPro
Protein Sequence (305 amino acids)
>BPHYT_RS16680 glutamine amidotransferase (Burkholderia phytofirmans PsJN) MNCAAPTDVTFSFTGFAARGGVTDHHADGWGIAFFEDKACRLFIDHQSSATSPIAEMVKR YPIKSKNTIAHIRKATQGHILLENCHPFMRELWGRHWIFAHNGDLKDYSPVLSGVYQPVG TTDSELAFCALLEGLRKAFPGAQQPPLDELFAALETLTREITQFGVFNFLMSNGQALFAH CSTHLYYIVRRWPFSTAHLVDADVSIDFAKYTTPEDRVAVIATKPLTDNEVWTAFEPGDL MMFQHGEVIGRVNVPVPDSVLEKLRNPALDASASATTIAASAETLAQPEAELDLEAADDT AAFES