Protein Info for BPHYT_RS16560 in Burkholderia phytofirmans PsJN

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 68 (17 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 555 to 574 (20 residues), see Phobius details PF20154: LNT_N" amino acids 37 to 214 (178 residues), 109.5 bits, see alignment E=1.9e-35 TIGR00546: apolipoprotein N-acyltransferase" amino acids 82 to 522 (441 residues), 315.5 bits, see alignment E=2.9e-98 PF00795: CN_hydrolase" amino acids 293 to 547 (255 residues), 83.3 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to bpy:Bphyt_3334)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYJ0 at UniProt or InterPro

Protein Sequence (582 amino acids)

>BPHYT_RS16560 apolipoprotein N-acyltransferase (Burkholderia phytofirmans PsJN)
MADPITSRSRRGVSASAAQQTRGRTLPRWHYLVALAAGAANTLSFAPTPHGGWLELAIFA
FFFAWLTRSTGWKSAALTGGAFGFGNFVTGVWWLYVSMHFYGGMAAPLAGAAVVLFSLYL
AIYPALAAGVWSFCAGHARNGAAMDDDTPFSPTWHGALAFASAWAIGEWLRGTVFTGFPW
LASGYAQVDGPFAGFAPVAGVYGVGWMLALVAALIVQAVLALLSSRKAARNGGVDLSNSG
KSARNGSDRNTATKPGLARVAVPAIIALALIAAGLLLPLVQWTVPANAPLTVRLLQGNVK
QEMKFEESGMRAAIDQFQQMITSKPADLIVTPETAIPVLAQQLPAPFASAVRNFSDSTGS
AILFGAIGGTITPEGQVIDYTNSLFGVTPGTRDVYRYDKHHLVPFGEFVPWGFRWFVNLM
SIPLGDFFRGAPVQKPFMVHNQPVAVDICYEDIFGEEIARTIRESATPAGVLVNSTNLAW
FGDTIALDQHLQIARMRSLETGRPMLRATNTGMTAAIDAHGKVIGRLTPYTIGSLDVTVQ
GTTGNTPYITSGNNTVLAVSLLLLAFGFAFGPGITRRRNGKQ