Protein Info for BPHYT_RS16460 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 370 (18 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 31 to 443 (413 residues), 96.9 bits, see alignment E=1.4e-31 PF07690: MFS_1" amino acids 45 to 303 (259 residues), 52.6 bits, see alignment E=3.5e-18 amino acids 302 to 446 (145 residues), 44.5 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3314)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYH0 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BPHYT_RS16460 major facilitator transporter (Burkholderia phytofirmans PsJN)
MQTHASPSATASPHSAQAPLSKAMVRRIVFSSSVGNALEWFDFLVYGYFATIIAKEFFPM
KDEWLSTLLAIATFGISFLMRPLGAVVLGIYGDRKGRKAALTLAIALMMVGTFTMAVMPP
YASIGIAAPILILLARLVQGFAVGGEFGSATAFMVEHSASRRGYYASWQFASQGLAAITA
AAFGSLLTAWMPPAQLNDWGWRLPFVFGLLVGPVGYYIRSHLDETPEFLALREAREAREV
AGARSTASEEKDASFASQWVNLLLAVGIVAQSTVGVYVLQLYMPMYAVKQLHMPAAASFG
VVVLNGGLQFLLSPVMGALSDRIGRIRIMLTTSILMGTLIYPMFALLQSHPTIGWLLLLQ
GTAGIFKAAYSGPMPALMSEIFPTQVRSTGLSIGYSIGVTIFGGFAPTIVETFIHLTGDK
LAPSYYVLIAAVLSGLSLAVVAWRMRRVRLMHGVQIA