Protein Info for BPHYT_RS16360 in Burkholderia phytofirmans PsJN

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR02012: protein RecA" amino acids 14 to 335 (322 residues), 570.9 bits, see alignment E=4.2e-176 PF00154: RecA" amino acids 17 to 279 (263 residues), 478.7 bits, see alignment E=1.2e-147 PF08423: Rad51" amino acids 47 to 238 (192 residues), 33.4 bits, see alignment E=7.1e-12 PF06745: ATPase" amino acids 50 to 226 (177 residues), 33.4 bits, see alignment E=7.7e-12 PF21096: RecA_C" amino acids 282 to 337 (56 residues), 95.5 bits, see alignment E=4.1e-31

Best Hits

Swiss-Prot: 91% identical to RECA_BURPS: Protein RecA (recA) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to bpy:Bphyt_3295)

MetaCyc: 72% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYF4 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BPHYT_RS16360 recombinase RecA (Burkholderia phytofirmans PsJN)
MEESKKGSAGLTAEKSKALAAALAQIEKQFGKGSVMRLGAGEAVEDIQVVSTGSLGLDIA
LGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVN
VNELLVSQPDTGEQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARL
MSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGS
IKKNDEVIGNETRVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAW
YSYSGERIGQGKDNAREFLRENPDIAREIENRIRESLGVNAMAEAVTGAAAEVADEEE