Protein Info for BPHYT_RS16345 in Burkholderia phytofirmans PsJN

Annotation: succinyl-CoA ligase [ADP-forming] subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 1 to 385 (385 residues), 533.6 bits, E=1.4e-164
• PF08442: ATP-grasp_2
  • amino acids 2 to 202 (201 residues), 268.7 bits, E=6e-84
• PF13549: ATP-grasp_5
  • amino acids 4 to 216 (213 residues), 40.7 bits, E=3.6e-14
• PF02786: CPSase_L_D2
  • amino acids 9 to 164 (156 residues), 23.2 bits, E=9.2e-09
• PF00549: Ligase_CoA
  • amino acids 262 to 382 (121 residues), 111.3 bits, E=7.1e-36

Best Hits

Swiss-Prot: 100% identical to SUCC_PARPJ: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 100% identity to bpy:Bphyt_3292)

MetaCyc: 83% identical to 3-sulfinopropionyl-CoA synthetase beta subunit (Advenella mimigardefordensis DPN7)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; 6.2.1.- [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• TCA cycle III (animals) (7/10 steps found)
• 3,3'-disulfanediyldipropannoate degradation (2/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

See B2SYE8 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BPHYT_RS16345 succinyl-CoA ligase [ADP-forming] subunit beta (Burkholderia phytofirmans PsJN)
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLDQVREYSEQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK
IVVMASSEGGMDVEEVAEKTPELIHKIAVDPATGLKDAEADELATKIGVPAASLPQARAI
LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKIMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVSLKVPLVVRMKGTNEDLGKKM
LAESGLPIIAADSMEEAAQKVVAAAAGKA