Protein Info for BPHYT_RS16325 in Burkholderia phytofirmans PsJN

Annotation: polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 382 to 399 (18 residues), see Phobius details amino acids 405 to 421 (17 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF15864: PglL_A" amino acids 169 to 193 (25 residues), 37.4 bits, see alignment (E = 2.4e-13) PF04932: Wzy_C" amino acids 209 to 363 (155 residues), 74.9 bits, see alignment E=9e-25 PF11846: Wzy_C_2" amino acids 385 to 552 (168 residues), 166.6 bits, see alignment E=9.4e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3288)

Predicted SEED Role

"Lipid A core - O-antigen ligase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYE4 at UniProt or InterPro

Protein Sequence (594 amino acids)

>BPHYT_RS16325 polymerase (Burkholderia phytofirmans PsJN)
MPTPFARYLSFSLLALALVLPYAVVNHTYPIPTFYAEFTALALYLATGAGVVLLVASARP
RVTFASPMVALVPLLFGLLLVAQSVVLPVSQPSMNWLGGGYLLAAFMATHAGYGFTRAKL
NETALRWAAGALIVGGLFAVFCQVIQLFHLEVRVSPLVVAYNVTVQRRPFGNMAQANHLA
TYIAFAMAGALFLVQTRRIAVSIWFLVSTIFAVGLALTVSRGPWLQMGVIVVAGFWMAFA
QMRDRSQVRRGNREWIIPIALAVLFFVINALIRWANVRYHLELGQSAAERFQDAGQIAPR
LALWKYGWTMFKTHPVLGVGWGEFPSYQYEFAKLLGGVEIANNSHDIFIDLLAKTGLVGL
AIVLFGLITWLVRVVRAPQSSARVFGIALIGVLVMHALVEYPQQYMFFLLPAMFVFGLLE
TRPLRFVPPRLSFGVFAVVVFGGLAALYPVYRDYARAEVLYYGQRPAEQYRADPSFLFQA
WGEYGMATLLPMNSTDLPLKLAMHKQAMALLPGETVLRRYAVLQALSGDQAGALDTVERL
KIFATELKDWPSQLSYVYQLCDEQKTLTGFKAELVKRYGIPAADVNEDDDSDEE