Protein Info for BPHYT_RS16315 in Burkholderia phytofirmans PsJN

Annotation: peptidase M48 Ste24p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 223 to 239 (17 residues), see Phobius details PF01435: Peptidase_M48" amino acids 151 to 326 (176 residues), 113.5 bits, see alignment E=5.7e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3286)

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYE2 at UniProt or InterPro

Protein Sequence (569 amino acids)

>BPHYT_RS16315 peptidase M48 Ste24p (Burkholderia phytofirmans PsJN)
MRPKRFLAALLSIALAAPPGAFAQSPGGSSIALNTLPAEPPLVSGPVDAYADPLVPSDIA
QGVFGVYGGAQSRFSGNTGVNANWRAPIVTQQLPDLGNGGSGSLTPQAERKLGERVMREL
RRDPDYLDDWLVRDYLNSVAAKLAAAASALYIGGYRPDFDLFAVRDPQINAFSLPGGFIG
VNTGLIVATQTESELASVLGHEMGHVLQRHISRMITTGERSTYAALAGLLFGVLAGVLAH
SGDLGSAIAIGGQAYAVDNQLRFSRSAEHEADRVGFLLLAGAGYDPYAMTTFFGRLDRAA
MSDTGIPAYARTHPLTGERIADMEDRARRAPYRQPHQSAEYGFVRARSRLLQDRSRSEYG
DEISRLRSEIEDRTAVNVAANWYGMAYGQMLFERYDDASASLASSRAAFATGEQAEGGTA
RSSPSLDVLAADIARRAGRDDEAARLAELAQRRWPQSNAAIDMHIRTLLTLHRFANAQAL
AQKETRIQPDQPAWWLYLAQASAGTGDALTQHRAMAEKFALEGAWLSAIRQLKDARDLKT
IGYYDLATVDARLHEMESRYQEERLDEKS