Protein Info for BPHYT_RS16210 in Burkholderia phytofirmans PsJN

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 56 to 499 (444 residues), 497.6 bits, see alignment E=1.6e-153 PF00089: Trypsin" amino acids 134 to 290 (157 residues), 71.3 bits, see alignment E=3.3e-23 PF13365: Trypsin_2" amino acids 134 to 267 (134 residues), 133.6 bits, see alignment E=2.8e-42 PF00595: PDZ" amino acids 304 to 370 (67 residues), 47.3 bits, see alignment E=6.8e-16 amino acids 416 to 491 (76 residues), 42.7 bits, see alignment E=1.9e-14 PF13180: PDZ_2" amino acids 306 to 396 (91 residues), 62.1 bits, see alignment E=1.6e-20 amino acids 418 to 501 (84 residues), 32 bits, see alignment E=3.8e-11 PF17820: PDZ_6" amino acids 333 to 386 (54 residues), 51.2 bits, see alignment 2.7e-17 amino acids 446 to 492 (47 residues), 48.7 bits, see alignment 1.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3265)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYC1 at UniProt or InterPro

Protein Sequence (504 amino acids)

>BPHYT_RS16210 peptidase (Burkholderia phytofirmans PsJN)
MNAKTLSRSAVAIAVAVALSAGYVAGHRDVPAPQVISPAQAAMMPAEAAAKTGIPDFSGL
VETYGPAVVNISAKHVVKQTALRGNPGNGNGGNQLPIDPSDPFYQFYKHFFGGMPGMQGG
DGGDAPDQPSASLGSGFIVSSDGYILTNAHVVDGANVVTVKLTDKREFKAKVVGADKQSD
VAVLKIDASNLPTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRSLPNENYTP
FIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINEAIKVKDDIVKT
GHVSRGRLGVAVQGMNQTLANSFGMQKPQGALVSSVDPGGPAAKGGLQPGDVILSVNGEP
VGDSADLPAQVAGLAPGTSATVQVWRDKATKDLKVTIGSLSDAKVASDKADQPTQLQGRL
GVAVRPLTPEEKSGASVSHGLLVQQSGGAAESAGIQPGDVILAVNGRPISSVDQLKQMIA
GAGNSIALLIQRDNAQIFVPVDLG