Protein Info for BPHYT_RS16140 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 43 to 73 (31 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 169 to 199 (31 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 241 to 257 (17 residues), see Phobius details PF00950: ABC-3" amino acids 4 to 255 (252 residues), 166.3 bits, see alignment E=4.9e-53

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 100% identity to bpy:Bphyt_3251)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYA7 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BPHYT_RS16140 ABC transporter permease (Burkholderia phytofirmans PsJN)
MFEYDFMVNAFAASGIVAVLAGVVGYFLVMRGQTFAGHALSHVGFTGATGAVLIGISPIW
GMIGFTLAAGVGMGALGERLAGRDVAIGVILSLSLGFGLLFLHFFTAYATQVTALLFGNV
LGVNTSTLGVLAGLGVVSLLALAAIMRPLLFASLQPELAEAKGVSLRLVSVLFLAIAALA
VAACTQIVGVLLVFTLMVGPAAAAQNMTTRLSAGLVLAAVFALLQAWLGLTLAFYTDWPT
SFWITVLSAVVYGGSLLRRH