Protein Info for BPHYT_RS16055 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 96 to 128 (33 residues), see Phobius details amino acids 134 to 162 (29 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 326 (265 residues), 158.4 bits, see alignment E=1.1e-50

Best Hits

Swiss-Prot: 53% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_3234)

MetaCyc: 49% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY90 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BPHYT_RS16055 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MNTPNPSSSPKTSTVNSDTPGAPVRFTWAALKRSTLFYPFIGLLVVCIVMVFASDSFLSG
ANIENVLRQVSINAIIAVGMTCVILTGGIDLSVGSVMALAGTLAAGLMVAGMNAVAALAI
GIAVGLGFGAANGFFVAFAGMPPIIVTLATMGIARGLALIYTGGYPIDGLPDWVSFFGSG
KILGVQAPVVIMAVIYVIAWVLLERMPFGRYVYAIGGNEQATRLSGVRVARVKLIVYTIA
GLTSAFAAIVLTARLMSGQPNAGVGFELDAIAAVVMGGTSISGGRGSIIGTLIGALLLGV
LNNGLNMVGVNPYVQNVIKGGIILLAIYISRDRRK