Protein Info for BPHYT_RS15825 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 25 to 41 (17 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 294 to 295 (2 residues), see Phobius details amino acids 297 to 299 (3 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 409 to 434 (26 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 28 to 429 (402 residues), 271.3 bits, see alignment E=7.8e-85 PF06609: TRI12" amino acids 28 to 246 (219 residues), 23.4 bits, see alignment E=2.1e-09 PF07690: MFS_1" amino acids 30 to 420 (391 residues), 167.6 bits, see alignment E=3.9e-53

Best Hits

Swiss-Prot: 54% identical to MDTD_SERP5: Putative multidrug resistance protein MdtD (mdtD) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3187)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6L5 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BPHYT_RS15825 major facilitator transporter (Burkholderia phytofirmans PsJN)
MSTPTPPAAASTTSSPPSPRSLTVMPWVVATGFFMQTLDSTIVNTALPAMATSLGELPLR
MQSVVIAYSLTMAVMIPVSGWLADKLGTRRVFFSAILVFAIASLLCANAHTLNQLVAFRI
MQGVGGAMLLPVGRLAVLRTFPAERYLPALSFVAIPGLIGPLIGPTLGGWLVKIASWHWI
FLINVPVGIVGCIATLIFMPDSRNEHVGKFDMKGYLLLIVGMVAISFALDGRTEFGIQHA
TVLVLLILSLACFVAYGLHAVREPSPIFSLDLFKIHTFSVGLLGNLFARIGSGAMPYLIP
LLLQVSLGYSAFEAGMMMLPVAAAGMASKRLVTHLIIKHSYRRVLIVNTVLVGLTMASFA
LTTANQPLWLRLVQLAFFGGVNSIQFTAMNTLTLKDLGTGGASSGNSLFSLVQMLSMSLG
VTVAGALLATFTGLLPRVTAANSLPAFHATFLCVGIITAGSSWIFAQLSPDIRTPAKKTD
PSERT