Protein Info for BPHYT_RS15775 in Burkholderia phytofirmans PsJN

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 134 to 163 (30 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 66 (46 residues), 25.1 bits, see alignment 1.3e-09 PF00528: BPD_transp_1" amino acids 107 to 288 (182 residues), 89.1 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 36% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_3177)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6K5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BPHYT_RS15775 peptide ABC transporter permease (Burkholderia phytofirmans PsJN)
MSTIVPPTPRAAAEPRFDELRLLLRSPTFVVGMVIVTWWIVCAIAGQWIVRIDPYASDPL
NSLTPPDSTHWFGTDQLGRDVFSRVIVGARDILTIAPLATLLGTIAGTTLGLIVGYFEGW
VDNVVGRAIDAVLALPLVIVALLALAAVGASNFTVILVIGITFTPITARTVRAAVFAERH
LDYVAAAQLRGERAPYIMFAEILPNVLPPIIVEATVRLGYAIFAVATLSFLGFGIQPPSA
DWGLALSESYTLMAGGAWWTVVFAAGAIASLVVGVNLIADSVQGVLDR