Protein Info for BPHYT_RS15770 in Burkholderia phytofirmans PsJN

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 21 to 96 (76 residues), 35 bits, see alignment E=1.4e-12 PF00528: BPD_transp_1" amino acids 132 to 331 (200 residues), 117.5 bits, see alignment E=6.1e-38

Best Hits

Swiss-Prot: 36% identical to GSIC_ECOL6: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_3176)

MetaCyc: 36% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"ABC transporter binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6K4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BPHYT_RS15770 peptide ABC transporter permease (Burkholderia phytofirmans PsJN)
MSTTVSPSASSAPSGNAGRVVRFLATRVGLSLITLWLLSVIVFAGGQLLPGDIGRAVLGP
LADARAVAALNHQLGADRPLMTQYVDWISHFVRGDMGLSYAYREPVRPFIAEALAHSAKL
GLLAFIVVVPLGIAGGVWSAMHAGRWLDRTISIAGLSATVVPEFVSSIVLILVFGVWLRW
LPIEASYPPEAGALEQLRHLVLPVLPLVLVFFGYIARMARAGTVEALDADYTRTAILKGL
PRHIVIWRHVLRNALLPTITVAATQLGYMIGGLVVVETLFHYQGIGSLIYNAAKAKDFPM
LEAGVLTIGVVYTVANLVADALHVLLNPRLRVRSAE